PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca34715.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 522aa    MW: 57665.5 Da    PI: 7.2084
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca34715.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA48.11.6e-15741135
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                C +Cg+ +TplWR+gp  ++ LCnaCG ++r kg+
  Dca34715.1  7 CYHCGVENTPLWRNGPPEKPVLCNACGSRWRTKGS 41
                ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.1E-8155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-10445No hitNo description
CDDcd002021.89E-14651No hitNo description
PfamPF003201.9E-13741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-11741IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011410.633740IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.8E-8283370IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MGKKGPCYHC GVENTPLWRN GPPEKPVLCN ACGSRWRTKG SLTNYTPLHS RLDPDGCEDR  60
RAIKMKCISL KKKDEKPNKR KLNYENTLGM DGEFTPDYKQ GYKKNIDEDT SNRSSSGSAI  120
SNESCAHFGS ADASDLTGPS QSVVRDALIP SWKRPCVTRP KQSSVEKLTK DLYTILHEQA  180
SQFSSSSEET LLYESEAPMV SVEIGHGSVL IRHPSSMARE EESEASSLSV DNKFCRADES  240
YSKDVLVPSP NGSNSVNKSC SRVGEVRKLN GQILPMDRLQ REKFNNEKLQ VLFSHKSPLS  300
YIDLTEIVNI DVFRGCLTDD EQQGLLKYLP SVDSCADFDS LESVFTSSHF IENLSSFQQL  360
LAEGVLDTSF SRVKTEDCNV VKRLALSNSS KCKLINHYNA LKNKGAEERI SQSRANSCFA  420
GPLISGKKFQ ESNYNNLGSA KATTKSSKKA LPKKEPKQKG TVQNDASHLT STPSNLFAFP  480
RDGGNEISDD EEDLLLDVPS NSSFPQAELL CPASSFGSYT HT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677131.10.0PREDICTED: GATA transcription factor 26
TrEMBLA0A0J8CE380.0A0A0J8CE38_BETVU; Uncharacterized protein
STRINGPOPTR_0003s08080.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.32e-95GATA transcription factor 26